CDS

Accession Number TCMCG024C32866
gbkey CDS
Protein Id XP_022010157.1
Location complement(join(43117602..43117727,43117877..43118041))
Gene LOC110909592
GeneID 110909592
Organism Helianthus annuus

Protein

Length 96aa
Molecule type protein
Topology linear
Data_file_division PLN
dblink BioProject:PRJNA396063
db_source XM_022154465.2
Definition coatomer subunit epsilon-2-like [Helianthus annuus]

EGGNOG-MAPPER Annotation

COG_category U
Description The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non- clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network. The coatomer complex is required for budding from Golgi membranes, and is essential for the retrograde Golgi-to-ER transport of dilysine-tagged proteins
KEGG_TC -
KEGG_Module -
KEGG_Reaction -
KEGG_rclass -
BRITE ko00000        [VIEW IN KEGG]
ko04131        [VIEW IN KEGG]
ko04147        [VIEW IN KEGG]
KEGG_ko ko:K17268        [VIEW IN KEGG]
EC -
KEGG_Pathway -
GOs GO:0005575        [VIEW IN EMBL-EBI]
GO:0005622        [VIEW IN EMBL-EBI]
GO:0005623        [VIEW IN EMBL-EBI]
GO:0005737        [VIEW IN EMBL-EBI]
GO:0005773        [VIEW IN EMBL-EBI]
GO:0005774        [VIEW IN EMBL-EBI]
GO:0005794        [VIEW IN EMBL-EBI]
GO:0005798        [VIEW IN EMBL-EBI]
GO:0005829        [VIEW IN EMBL-EBI]
GO:0006810        [VIEW IN EMBL-EBI]
GO:0006888        [VIEW IN EMBL-EBI]
GO:0006890        [VIEW IN EMBL-EBI]
GO:0006891        [VIEW IN EMBL-EBI]
GO:0008150        [VIEW IN EMBL-EBI]
GO:0012505        [VIEW IN EMBL-EBI]
GO:0012506        [VIEW IN EMBL-EBI]
GO:0016020        [VIEW IN EMBL-EBI]
GO:0016192        [VIEW IN EMBL-EBI]
GO:0030117        [VIEW IN EMBL-EBI]
GO:0030120        [VIEW IN EMBL-EBI]
GO:0030126        [VIEW IN EMBL-EBI]
GO:0030135        [VIEW IN EMBL-EBI]
GO:0030137        [VIEW IN EMBL-EBI]
GO:0030659        [VIEW IN EMBL-EBI]
GO:0030660        [VIEW IN EMBL-EBI]
GO:0030662        [VIEW IN EMBL-EBI]
GO:0030663        [VIEW IN EMBL-EBI]
GO:0031090        [VIEW IN EMBL-EBI]
GO:0031410        [VIEW IN EMBL-EBI]
GO:0031982        [VIEW IN EMBL-EBI]
GO:0032991        [VIEW IN EMBL-EBI]
GO:0043226        [VIEW IN EMBL-EBI]
GO:0043227        [VIEW IN EMBL-EBI]
GO:0043229        [VIEW IN EMBL-EBI]
GO:0043231        [VIEW IN EMBL-EBI]
GO:0044422        [VIEW IN EMBL-EBI]
GO:0044424        [VIEW IN EMBL-EBI]
GO:0044425        [VIEW IN EMBL-EBI]
GO:0044431        [VIEW IN EMBL-EBI]
GO:0044433        [VIEW IN EMBL-EBI]
GO:0044437        [VIEW IN EMBL-EBI]
GO:0044444        [VIEW IN EMBL-EBI]
GO:0044446        [VIEW IN EMBL-EBI]
GO:0044464        [VIEW IN EMBL-EBI]
GO:0046907        [VIEW IN EMBL-EBI]
GO:0048193        [VIEW IN EMBL-EBI]
GO:0048475        [VIEW IN EMBL-EBI]
GO:0051179        [VIEW IN EMBL-EBI]
GO:0051234        [VIEW IN EMBL-EBI]
GO:0051641        [VIEW IN EMBL-EBI]
GO:0051649        [VIEW IN EMBL-EBI]
GO:0097708        [VIEW IN EMBL-EBI]
GO:0098588        [VIEW IN EMBL-EBI]
GO:0098796        [VIEW IN EMBL-EBI]
GO:0098805        [VIEW IN EMBL-EBI]

Sequence

CDS:  
ATGGCGGGAGCACCAGATCTGTTATTCGCACTGAGAAACAACTTCTACTTCGGAGCATTTCAAGCAGCAATCAACAGCGGCGATGTTCAAAACCTCTCCAAAGAGGATGCGATCGAACGCAATTGCCTCATTTACAGATCCTACATTGCTCTCGGAAGCTATCAAATCTGTGAATGTGTGAGTGGTATGGATGCTAGATATGTGGATGTGTTGCCCTACTGGCCCGAAAAATGGCTCCGGTCGTCGGAGTATAGAGAGAAGGCAGAGAGTGTTTGGTGTGCTATGATTTAA
Protein:  
MAGAPDLLFALRNNFYFGAFQAAINSGDVQNLSKEDAIERNCLIYRSYIALGSYQICECVSGMDARYVDVLPYWPEKWLRSSEYREKAESVWCAMI